Lineage for d1ay9a_ (1ay9 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18251Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
  4. 18252Superfamily b.87.1: LexA/Signal peptidase [51306] (2 families) (S)
  5. 18253Family b.87.1.1: LexA-related [51307] (2 proteins)
  6. 18258Protein UmuD' [51308] (1 species)
  7. 18259Species Escherichia coli [TaxId:562] [51309] (2 PDB entries)
  8. 18262Domain d1ay9a_: 1ay9 A: [28384]

Details for d1ay9a_

PDB Entry: 1ay9 (more details), 3 Å

PDB Description: wild-type umud' from e. coli

SCOP Domain Sequences for d1ay9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay9a_ b.87.1.1 (A:) UmuD' {Escherichia coli}
dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr

SCOP Domain Coordinates for d1ay9a_:

Click to download the PDB-style file with coordinates for d1ay9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ay9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ay9b_