Lineage for d1umub_ (1umu B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.87: LexA/Signal peptidase [51305] (1 superfamily) Superfamily b.87.1: LexA/Signal peptidase [51306] (2 families) 
Family b.87.1.1: LexA-related [51307] (2 proteins) 
Protein UmuD' [51308] (1 species) Species Escherichia coli [TaxId:562] [51309] (2 PDB entries) 
Domain d1umub_: 1umu B: [28383]
Details for d1umub_
PDB Entry: 1umu (more details), 2.5 Å
PDB Description: structure determination of umud' by mad phasing of the selenomethionyl protein
SCOP Domain Sequences for d1umub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umub_ b.87.1.1 (B:) UmuD' {Escherichia coli}
dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvka
SCOP Domain Coordinates for d1umub_:
Click to download the PDB-style file with coordinates for d1umub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1umub_:
- d1umub_ appears in SCOP 1.57
- d1umub_ appears in the current release, SCOPe 2.08
View in 3D
