Lineage for d1am2a_ (1am2 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073129Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2073130Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2073135Family b.86.1.2: Intein (protein splicing domain) [51298] (5 protein domains)
  6. 2073139Protein GyrA intein [51303] (1 species)
    miniintein lacking the homing endonuclease domain
  7. 2073140Species Mycobacterium xenopi [TaxId:1789] [51304] (1 PDB entry)
  8. 2073141Domain d1am2a_: 1am2 A: [28381]

Details for d1am2a_

PDB Entry: 1am2 (more details), 2.2 Å

PDB Description: gyra intein from mycobacterium xenopi
PDB Compounds: (A:) mxe gyra intein

SCOPe Domain Sequences for d1am2a_:

Sequence, based on SEQRES records: (download)

>d1am2a_ b.86.1.2 (A:) GyrA intein {Mycobacterium xenopi [TaxId: 1789]}
asitgdalvalpegesvriadivpgarpnsdnaidlkvldrhgnpvladrlfhsgehpvy
avrtveglrvtgtanhpllclvdvagvptllwklideikpgdyaviqrsafsvdcagfar
gkpefapttytvgvpglvrfleahhrdpdakaiadeltdgrfyyakvasvtdagvqpvys
lrvdtadhafitngfvshn

Sequence, based on observed residues (ATOM records): (download)

>d1am2a_ b.86.1.2 (A:) GyrA intein {Mycobacterium xenopi [TaxId: 1789]}
asitgdalvalpegesvriadivpgarpnsdnaidlkvldrhgnpvladrlfhsgehpvy
avrtveglrvtgtanhpllclvdvagvptllwklideikpgdyaviqrsafstvgvpglv
rfleahhrdpdakaiadeltdgrfyyakvasvtdagvqpvyslrvdtadhafitngfvsh
n

SCOPe Domain Coordinates for d1am2a_:

Click to download the PDB-style file with coordinates for d1am2a_.
(The format of our PDB-style files is described here.)

Timeline for d1am2a_: