Lineage for d1dq3a1 (1dq3 A:1-128,A:415-454)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18231Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
  4. 18232Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
  5. 18237Family b.86.1.2: Intein (protein splicing domain) [51298] (3 proteins)
  6. 18241Protein PI-Pfui intein [51301] (1 species)
  7. 18242Species Pyrococcus furiosus [TaxId:186497] [51302] (1 PDB entry)
  8. 18243Domain d1dq3a1: 1dq3 A:1-128,A:415-454 [28380]
    Other proteins in same PDB: d1dq3a2, d1dq3a3, d1dq3a4

Details for d1dq3a1

PDB Entry: 1dq3 (more details), 2.1 Å

PDB Description: crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui

SCOP Domain Sequences for d1dq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq3a1 b.86.1.2 (A:1-128,A:415-454) PI-Pfui intein {Pyrococcus furiosus}
cidgkakiifenegeehlttmeemyerykhlgefydeeynrwgidvsnvpiyvksfdpes
krvvkgkvnviwkyelgkdvtkyeiitnkgtkiltspwhpffvltpdfkivekradelke
gdiliggmXglevvrhitttneprtfydltvenyqnylagengmifvhn

SCOP Domain Coordinates for d1dq3a1:

Click to download the PDB-style file with coordinates for d1dq3a1.
(The format of our PDB-style files is described here.)

Timeline for d1dq3a1: