Lineage for d1vdea1 (1vde A:1-180,A:416-454)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18231Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
  4. 18232Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
  5. 18237Family b.86.1.2: Intein (protein splicing domain) [51298] (3 proteins)
  6. 18244Protein PI-Scei intein [51299] (1 species)
  7. 18245Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (3 PDB entries)
  8. 18249Domain d1vdea1: 1vde A:1-180,A:416-454 [28378]
    Other proteins in same PDB: d1vdea2, d1vdea3, d1vdeb2, d1vdeb3

Details for d1vdea1

PDB Entry: 1vde (more details), 2.4 Å

PDB Description: pi-scei, a homing endonuclease with protein splicing activity

SCOP Domain Sequences for d1vdea1:

Sequence, based on SEQRES records: (download)

>d1vdea1 b.86.1.2 (A:1-180,A:416-454) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

Sequence, based on observed residues (ATOM records): (download)

>d1vdea1 b.86.1.2 (A:1-180,A:416-454) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlevitfemgqkkapdgrivelvkevsksy
pisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXcrgfyfelq
elkeddyygitlsddsdhqfllanqvvvhn

SCOP Domain Coordinates for d1vdea1:

Click to download the PDB-style file with coordinates for d1vdea1.
(The format of our PDB-style files is described here.)

Timeline for d1vdea1: