Lineage for d1vdea1 (1vde A:1-180,A:416-454)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073129Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2073130Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2073135Family b.86.1.2: Intein (protein splicing domain) [51298] (5 protein domains)
  6. 2073145Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 2073146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (8 PDB entries)
    Uniprot P17255 284-737
  8. 2073153Domain d1vdea1: 1vde A:1-180,A:416-454 [28378]
    Other proteins in same PDB: d1vdea2, d1vdea3, d1vdeb2, d1vdeb3

Details for d1vdea1

PDB Entry: 1vde (more details), 2.4 Å

PDB Description: pi-scei, a homing endonuclease with protein splicing activity
PDB Compounds: (A:) pi-scei

SCOPe Domain Sequences for d1vdea1:

Sequence, based on SEQRES records: (download)

>d1vdea1 b.86.1.2 (A:1-180,A:416-454) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

Sequence, based on observed residues (ATOM records): (download)

>d1vdea1 b.86.1.2 (A:1-180,A:416-454) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlevitfemgqkkapdgrivelvkevsksy
pisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXcrgfyfelq
elkeddyygitlsddsdhqfllanqvvvhn

SCOPe Domain Coordinates for d1vdea1:

Click to download the PDB-style file with coordinates for d1vdea1.
(The format of our PDB-style files is described here.)

Timeline for d1vdea1: