Lineage for d1ef0a1 (1ef0 A:1-180,A:416-455)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568397Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 568398Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
    duplication: contains two intertwined structural repeats
  5. 568403Family b.86.1.2: Intein (protein splicing domain) [51298] (4 proteins)
  6. 568413Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 568414Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (8 PDB entries)
  8. 568419Domain d1ef0a1: 1ef0 A:1-180,A:416-455 [28376]
    Other proteins in same PDB: d1ef0a2, d1ef0a3, d1ef0b2, d1ef0b3

Details for d1ef0a1

PDB Entry: 1ef0 (more details), 2.1 Å

PDB Description: crystal structure of pi-scei miniprecursor

SCOP Domain Sequences for d1ef0a1:

Sequence, based on SEQRES records: (download)

>d1ef0a1 b.86.1.2 (A:1-180,A:416-455) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
afakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhac

Sequence, based on observed residues (ATOM records): (download)

>d1ef0a1 b.86.1.2 (A:1-180,A:416-455) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
afakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrvitfemgqkkapdgrivelvkevsksypis
egperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXcrgfyfelqelk
eddyygitlsddsdhqfllanqvvvhac

SCOP Domain Coordinates for d1ef0a1:

Click to download the PDB-style file with coordinates for d1ef0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ef0a1: