Lineage for d1dfaa1 (1dfa A:1-180,A:416-454)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471603Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 471604Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
    duplication: contains two intertwined structural repeats
  5. 471609Family b.86.1.2: Intein (protein splicing domain) [51298] (4 proteins)
  6. 471619Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 471620Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (8 PDB entries)
  8. 471624Domain d1dfaa1: 1dfa A:1-180,A:416-454 [28375]
    Other proteins in same PDB: d1dfaa2, d1dfaa3

Details for d1dfaa1

PDB Entry: 1dfa (more details), 2 Å

PDB Description: crystal structure of pi-scei in c2 space group

SCOP Domain Sequences for d1dfaa1:

Sequence, based on SEQRES records: (download)

>d1dfaa1 b.86.1.2 (A:1-180,A:416-454) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

Sequence, based on observed residues (ATOM records): (download)

>d1dfaa1 b.86.1.2 (A:1-180,A:416-454) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisekayfewtieardlsllgshvrkatyqtyaXcrgfyfelqelkeddy
ygitlsddsdhqfllanqvvvhn

SCOP Domain Coordinates for d1dfaa1:

Click to download the PDB-style file with coordinates for d1dfaa1.
(The format of our PDB-style files is described here.)

Timeline for d1dfaa1: