Lineage for d1at0__ (1at0 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18231Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
  4. 18232Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
  5. 18233Family b.86.1.1: Hedgehog C-terminal (Hog) autoprocessing domain [51295] (1 protein)
  6. 18234Protein Hedgehog [51296] (1 species)
  7. 18235Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [51297] (1 PDB entry)
  8. 18236Domain d1at0__: 1at0 - [28374]

Details for d1at0__

PDB Entry: 1at0 (more details), 1.9 Å

PDB Description: 17-kda fragment of hedgehog c-terminal autoprocessing domain

SCOP Domain Sequences for d1at0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1at0__ b.86.1.1 (-) Hedgehog {Fruit fly (Drosophila melanogaster)}
cftpestallesgvrkplgelsigdrvlsmtangqavysevilfmdrnleqmqnfvqlht
dggavltvtpahlvsvwqpesqkltfvfadrieeknqvlvrdvetgelrpqrvvkvgsvr
skgvvapltregtivvnsvaascya

SCOP Domain Coordinates for d1at0__:

Click to download the PDB-style file with coordinates for d1at0__.
(The format of our PDB-style files is described here.)

Timeline for d1at0__: