Lineage for d1at0a_ (1at0 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. Family b.86.1.1: Hedgehog C-terminal (Hog) autoprocessing domain [51295] (2 proteins)
    automatically mapped to Pfam PF01079
  6. Protein Hedgehog [51296] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [51297] (1 PDB entry)
  8. Domain d1at0a_: 1at0 A: [28374]

Details for d1at0a_

PDB Entry: 1at0 (more details), 1.9 Å

PDB Description: 17-kda fragment of hedgehog c-terminal autoprocessing domain
PDB Compounds: (A:) 17-hedgehog

SCOPe Domain Sequences for d1at0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1at0a_ b.86.1.1 (A:) Hedgehog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cftpestallesgvrkplgelsigdrvlsmtangqavysevilfmdrnleqmqnfvqlht
dggavltvtpahlvsvwqpesqkltfvfadrieeknqvlvrdvetgelrpqrvvkvgsvr
skgvvapltregtivvnsvaascya

SCOPe Domain Coordinates for d1at0a_ are not available.

Timeline for d1at0a_: