![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily) complex fold made of five beta-hairpin units and a b-ribbon arc |
![]() | Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) ![]() duplication: contains two intertwined structural repeats |
![]() | Family b.86.1.1: Hedgehog C-terminal (Hog) autoprocessing domain [51295] (2 proteins) automatically mapped to Pfam PF01079 |
![]() | Protein Hedgehog [51296] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [51297] (1 PDB entry) |
![]() | Domain d1at0a_: 1at0 A: [28374] |
PDB Entry: 1at0 (more details), 1.9 Å
SCOPe Domain Sequences for d1at0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1at0a_ b.86.1.1 (A:) Hedgehog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} cftpestallesgvrkplgelsigdrvlsmtangqavysevilfmdrnleqmqnfvqlht dggavltvtpahlvsvwqpesqkltfvfadrieeknqvlvrdvetgelrpqrvvkvgsvr skgvvapltregtivvnsvaascya
Timeline for d1at0a_: