SCOPe 2.07: Domain d1duca_: 1duc A:

Lineage for d1duca_ (1duc A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Equine infectious anemia virus [TaxId:11665] [51288] (2 PDB entries)

8. Domain d1duca_: 1duc A: [28372]
   complexed with dud, sr

Details for d1duca_

PDB Entry: 1duc, 2.05 Å

PDB Description: eiav dutpase dudp/strontium complex

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1duca_:

Sequence; same for both SEQRES and ATOM records:

>d1duca_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]}
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwden

Timeline for d1duca_:

• d1duca_ first appeared (with stable ids) in SCOP 1.55, called d1duc__
  
• d1duca_ appears in SCOPe 2.06
  
• d1duca_ appears in the current release, SCOPe 2.08