SCOP 1.67: Domain d1dun__: 1dun -

Lineage for d1dun__ (1dun -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species)

7. Species Equine infectious anemia virus [TaxId:11665] [51288] (2 PDB entries)

8. Domain d1dun__: 1dun - [28371]

Details for d1dun__

PDB Entry: 1dun, 1.9 Å

PDB Description: eiav dutpase native

SCOP Domain Sequences for d1dun__:

Sequence; same for both SEQRES and ATOM records:

>d1dun__ b.85.4.1 (-) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus}
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki

Timeline for d1dun__:

• d1dun__ first appeared (with stable ids) in SCOP 1.55
  
• d1dun__ appears in SCOP 1.65
  
• d1dun__ appears in SCOP 1.69
  
• d1dun__ appears in the current release, SCOPe 2.08, called d1duna_