Lineage for d1dun__ (1dun -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63938Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 64023Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) (S)
  5. 64024Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein)
  6. 64025Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species)
  7. 64026Species Equine infectious anemia virus [TaxId:11665] [51288] (2 PDB entries)
  8. 64027Domain d1dun__: 1dun - [28371]

Details for d1dun__

PDB Entry: 1dun (more details), 1.9 Å

PDB Description: eiav dutpase native

SCOP Domain Sequences for d1dun__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dun__ b.85.4.1 (-) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus}
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki

SCOP Domain Coordinates for d1dun__:

Click to download the PDB-style file with coordinates for d1dun__.
(The format of our PDB-style files is described here.)

Timeline for d1dun__: