Lineage for d1f7pb_ (1f7p B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811150Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 811151Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 811183Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)
  7. 811198Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 811207Domain d1f7pb_: 1f7p B: [28364]

Details for d1f7pb_

PDB Entry: 1f7p (more details), 2.3 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.
PDB Compounds: (B:) Pol polyprotein

SCOP Domain Sequences for d1f7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7pb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv

SCOP Domain Coordinates for d1f7pb_:

Click to download the PDB-style file with coordinates for d1f7pb_.
(The format of our PDB-style files is described here.)

Timeline for d1f7pb_: