| Class b: All beta proteins [48724] (180 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
| Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
| Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
| Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries) |
| Domain d1f7pb_: 1f7p B: [28364] complexed with udp |
PDB Entry: 1f7p (more details), 2.3 Å
SCOPe Domain Sequences for d1f7pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7pb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv
Timeline for d1f7pb_: