Lineage for d1f7pa_ (1f7p A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427488Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2427503Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 2427512Domain d1f7pa_: 1f7p A: [28363]
    complexed with udp

Details for d1f7pa_

PDB Entry: 1f7p (more details), 2.3 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1f7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7pa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv

SCOPe Domain Coordinates for d1f7pa_:

Click to download the PDB-style file with coordinates for d1f7pa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7pa_: