![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (1 family) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (2 proteins) |
![]() | Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (4 species) |
![]() | Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries) |
![]() | Domain d1f7ra_: 1f7r A: [28360] complexed with mg, udp |
PDB Entry: 1f7r (more details), 2.5 Å
SCOP Domain Sequences for d1f7ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7ra_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus} miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvvmds ergdngygstgvf
Timeline for d1f7ra_: