SCOPe 2.08: Domain d1w9ha2: 1w9h A:11-170

Lineage for d1w9ha2 (1w9h A:11-170)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families)

5. Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
   PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)

6. Protein Hypothetical protein AF1318 [310688] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [310905] (3 PDB entries)

8. Domain d1w9ha2: 1w9h A:11-170 [283593]
   Other proteins in same PDB: d1w9ha3
   complexed with cd, cl, ni

Details for d1w9ha2

PDB Entry: 1w9h, 1.95 Å

PDB Description: the structure of a piwi protein from archaeoglobus fulgidus.

PDB Compounds: (A:) hypothetical protein af1318

SCOPe Domain Sequences for d1w9ha2:

Sequence, based on SEQRES records:

>d1w9ha2 c.44.3.1 (A:11-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
ltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfsslinqlksqiss
kidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntplyyklksyl
insipsqfmrydilsnrnltfyvdnllvqfvsklggkpwi

Sequence, based on observed residues (ATOM records):

>d1w9ha2 c.44.3.1 (A:11-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
ltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfsslinqlksqiss
kidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntplyyklksyl
insipsqfmrydiltfyvdnllvqfvsklggkpwi

Timeline for d1w9ha2:

• d1w9ha2 first appeared in SCOPe 2.06
  
• d1w9ha2 appears in SCOPe 2.07