Lineage for d1w9ha2 (1w9h A:11-170)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116195Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2116196Family c.44.3.1: PIWI domain N-terminal [310609] (4 protein domains)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)
  6. 2116240Protein Hypothetical protein AF1318 [310688] (1 species)
  7. 2116241Species Archaeoglobus fulgidus [TaxId:2234] [310905] (3 PDB entries)
  8. 2116242Domain d1w9ha2: 1w9h A:11-170 [283593]
    Other proteins in same PDB: d1w9ha3
    complexed with cd, cl, ni

Details for d1w9ha2

PDB Entry: 1w9h (more details), 1.95 Å

PDB Description: the structure of a piwi protein from archaeoglobus fulgidus.
PDB Compounds: (A:) hypothetical protein af1318

SCOPe Domain Sequences for d1w9ha2:

Sequence, based on SEQRES records: (download)

>d1w9ha2 c.44.3.1 (A:11-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
ltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfsslinqlksqiss
kidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntplyyklksyl
insipsqfmrydilsnrnltfyvdnllvqfvsklggkpwi

Sequence, based on observed residues (ATOM records): (download)

>d1w9ha2 c.44.3.1 (A:11-170) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
ltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfsslinqlksqiss
kidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntplyyklksyl
insipsqfmrydiltfyvdnllvqfvsklggkpwi

SCOPe Domain Coordinates for d1w9ha2:

Click to download the PDB-style file with coordinates for d1w9ha2.
(The format of our PDB-style files is described here.)

Timeline for d1w9ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9ha3