SCOP 1.65: Domain d1f7oa_: 1f7o A:

Lineage for d1f7oa_ (1f7o A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (4 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)

8. Domain d1f7oa_: 1f7o A: [28357]

Details for d1f7oa_

PDB Entry: 1f7o, 2.2 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.

SCOP Domain Sequences for d1f7oa_:

Sequence; same for both SEQRES and ATOM records:

>d1f7oa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv

Timeline for d1f7oa_:

• d1f7oa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f7oa_ appears in SCOP 1.63
  
• d1f7oa_ appears in SCOP 1.67
  
• d1f7oa_ appears in the current release, SCOPe 2.08