Lineage for d1f7oa_ (1f7o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818142Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2818157Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 2818160Domain d1f7oa_: 1f7o A: [28357]

Details for d1f7oa_

PDB Entry: 1f7o (more details), 2.2 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1f7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7oa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv

SCOPe Domain Coordinates for d1f7oa_:

Click to download the PDB-style file with coordinates for d1f7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7oa_: