SCOP 1.67: Domain d1dutb_: 1dut B:

Lineage for d1dutb_ (1dut B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)

8. Domain d1dutb_: 1dut B: [28356]
   complexed with mg

Details for d1dutb_

PDB Entry: 1dut, 1.9 Å

PDB Description: fiv dutp pyrophosphatase

SCOP Domain Sequences for d1dutb_:

Sequence; same for both SEQRES and ATOM records:

>d1dutb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvv

Timeline for d1dutb_:

• d1dutb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dutb_ appears in SCOP 1.65
  
• d1dutb_ appears in SCOP 1.69
  
• d1dutb_ appears in the current release, SCOPe 2.08