Lineage for d1dutb_ (1dut B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235002Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 235090Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 235091Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein)
  6. 235092Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (4 species)
  7. 235101Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 235105Domain d1dutb_: 1dut B: [28356]
    complexed with mg

Details for d1dutb_

PDB Entry: 1dut (more details), 1.9 Å

PDB Description: fiv dutp pyrophosphatase

SCOP Domain Sequences for d1dutb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dutb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvv

SCOP Domain Coordinates for d1dutb_:

Click to download the PDB-style file with coordinates for d1dutb_.
(The format of our PDB-style files is described here.)

Timeline for d1dutb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1duta_