Lineage for d1dutb_ (1dut B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.85: beta-clip [51268] (6 superfamilies) Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) 
Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species) 
Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries) 
Domain d1dutb_: 1dut B: [28356]
Details for d1dutb_
PDB Entry: 1dut (more details), 1.9 Å
PDB Description: fiv dutp pyrophosphatase
SCOP Domain Sequences for d1dutb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dutb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvv
SCOP Domain Coordinates for d1dutb_:
Click to download the PDB-style file with coordinates for d1dutb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dutb_:
- d1dutb_ first appeared (with stable ids) in SCOP 1.55
- d1dutb_ appears in SCOP 1.59
- d1dutb_ appears in SCOP 1.63
- d1dutb_ appears in the current release, SCOPe 2.08
View in 3D
