Lineage for d1dutb_ (1dut B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (2 families) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axis
Family b.85.4.1: dUTPase-like [51284] (5 proteins) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) 
Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries) 
Domain d1dutb_: 1dut B: [28356]
complexed with mg
Details for d1dutb_
PDB Entry: 1dut (more details), 1.9 Å
PDB Description: fiv dutp pyrophosphatase
PDB Compounds: (B:) dUTP pyrophosphataseSCOPe Domain Sequences for d1dutb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dutb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvv
SCOPe Domain Coordinates for d1dutb_:
Click to download the PDB-style file with coordinates for d1dutb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dutb_:
- d1dutb_ first appeared (with stable ids) in SCOP 1.55
- d1dutb_ appears in SCOPe 2.07
View in 3D
