SCOP 1.63: Domain d1f7db_: 1f7d B:

Lineage for d1f7db_ (1f7d B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (4 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)

8. Domain d1f7db_: 1f7d B: [28354]
   complexed with mg

Details for d1f7db_

PDB Entry: 1f7d, 1.4 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms

SCOP Domain Sequences for d1f7db_:

Sequence; same for both SEQRES and ATOM records:

>d1f7db_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvv

Timeline for d1f7db_:

• d1f7db_ first appeared (with stable ids) in SCOP 1.55
  
• d1f7db_ appears in SCOP 1.61
  
• d1f7db_ appears in SCOP 1.65
  
• d1f7db_ appears in the current release, SCOPe 2.08