SCOPe 2.06: Domain d1duda1: 1dud A:2-136

Lineage for d1duda1 (1dud A:2-136)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
   Uniprot P06968

8. Domain d1duda1: 1dud A:2-136 [28352]
   Other proteins in same PDB: d1duda2
   complexed with dud

Details for d1duda1

PDB Entry: 1dud, 2.3 Å

PDB Description: deoxyuridine 5'-triphosphate nucleotide hydrolase (d-utpase) complexed with the substrate analogue deoxyuridine 5'-diphosphate (d-udp)

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1duda1:

Sequence; same for both SEQRES and ATOM records:

>d1duda1 b.85.4.1 (A:2-136) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedf

Timeline for d1duda1:

• d1duda1 first appeared (with stable ids) in SCOP 1.55, called d1dud__
  
• d1duda1 was called d1duda_ in SCOPe 2.05
  
• d1duda1 appears in SCOPe 2.07
  
• d1duda1 appears in the current release, SCOPe 2.08