SCOP 1.67: Domain d1euwa_: 1euw A:

Lineage for d1euwa_ (1euw A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species)

7. Species Escherichia coli [TaxId:562] [51286] (4 PDB entries)

8. Domain d1euwa_: 1euw A: [28349]
   complexed with emc, gol

Details for d1euwa_

PDB Entry: 1euw, 1.05 Å

PDB Description: atomic resolution structure of e. coli dutpase

SCOP Domain Sequences for d1euwa_:

Sequence; same for both SEQRES and ATOM records:

>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedf

Timeline for d1euwa_:

• d1euwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1euwa_ appears in SCOP 1.65
  
• d1euwa_ appears in SCOP 1.69
  
• d1euwa_ appears in the current release, SCOPe 2.08, called d1euwa1