Lineage for d3ubpb_ (3ubp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817976Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2817977Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2817978Protein Urease, beta-subunit [51280] (4 species)
  7. 2817979Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)
  8. 2817986Domain d3ubpb_: 3ubp B: [28348]
    Other proteins in same PDB: d3ubpa_, d3ubpc1, d3ubpc2
    complexed with 2pa, ni

Details for d3ubpb_

PDB Entry: 3ubp (more details), 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease
PDB Compounds: (B:) protein (urease beta subunit)

SCOPe Domain Sequences for d3ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d3ubpb_:

Click to download the PDB-style file with coordinates for d3ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ubpb_: