SCOP 1.67: Domain d2ubpb_: 2ubp B:

Lineage for d2ubpb_ (2ubp B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (6 PDB entries)

8. Domain d2ubpb_: 2ubp B: [28347]
   Other proteins in same PDB: d2ubpa_, d2ubpc1, d2ubpc2

Details for d2ubpb_

PDB Entry: 2ubp, 2 Å

PDB Description: structure of native urease from bacillus pasteurii

SCOP Domain Sequences for d2ubpb_:

Sequence; same for both SEQRES and ATOM records:

>d2ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d2ubpb_:

• d2ubpb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ubpb_ appears in SCOP 1.65
  
• d2ubpb_ appears in SCOP 1.69
  
• d2ubpb_ appears in the current release, SCOPe 2.08