Lineage for d2ubpb_ (2ubp B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18112Fold b.85: beta-clip [51268] (5 superfamilies)
  4. 18162Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 18163Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 18164Protein Urease, beta-subunit [51280] (2 species)
  7. 18165Species Bacillus pasteurii [TaxId:1474] [51282] (4 PDB entries)
  8. 18168Domain d2ubpb_: 2ubp B: [28347]
    Other proteins in same PDB: d2ubpa_, d2ubpc1, d2ubpc2

Details for d2ubpb_

PDB Entry: 2ubp (more details), 2 Å

PDB Description: structure of native urease from bacillus pasteurii

SCOP Domain Sequences for d2ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOP Domain Coordinates for d2ubpb_:

Click to download the PDB-style file with coordinates for d2ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d2ubpb_: