Lineage for d2ubpb_ (2ubp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817976Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2817977Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2817978Protein Urease, beta-subunit [51280] (4 species)
  7. 2817979Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)
  8. 2817988Domain d2ubpb_: 2ubp B: [28347]
    Other proteins in same PDB: d2ubpa_, d2ubpc1, d2ubpc2
    complexed with ni, so4

Details for d2ubpb_

PDB Entry: 2ubp (more details), 2 Å

PDB Description: structure of native urease from bacillus pasteurii
PDB Compounds: (B:) protein (urease beta subunit)

SCOPe Domain Sequences for d2ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d2ubpb_:

Click to download the PDB-style file with coordinates for d2ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d2ubpb_: