Lineage for d1ubpb_ (1ubp B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427322Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2427323Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2427324Protein Urease, beta-subunit [51280] (4 species)
  7. 2427325Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)
  8. 2427332Domain d1ubpb_: 1ubp B: [28346]
    Other proteins in same PDB: d1ubpa_, d1ubpc1, d1ubpc2
    complexed with bme, ni

Details for d1ubpb_

PDB Entry: 1ubp (more details), 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution
PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d1ubpb_:

Click to download the PDB-style file with coordinates for d1ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d1ubpb_: