SCOPe 2.02: Domain d1ubpb_: 1ubp B:

Lineage for d1ubpb_ (1ubp B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (6 PDB entries)

8. Domain d1ubpb_: 1ubp B: [28346]
   Other proteins in same PDB: d1ubpa_, d1ubpc1, d1ubpc2
   complexed with bme, ni

Details for d1ubpb_

PDB Entry: 1ubp, 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution

PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1ubpb_:

Sequence; same for both SEQRES and ATOM records:

>d1ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d1ubpb_:

• d1ubpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ubpb_ appears in SCOPe 2.01
  
• d1ubpb_ appears in SCOPe 2.03
  
• d1ubpb_ appears in the current release, SCOPe 2.08