Class b: All beta proteins [48724] (119 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) |
Family b.85.3.1: Urease, beta-subunit [51279] (1 protein) |
Protein Urease, beta-subunit [51280] (3 species) |
Species Bacillus pasteurii [TaxId:1474] [51282] (5 PDB entries) |
Domain d1ubpb_: 1ubp B: [28346] Other proteins in same PDB: d1ubpa_, d1ubpc1, d1ubpc2 complexed with bme, cbx, ni |
PDB Entry: 1ubp (more details), 1.65 Å
SCOP Domain Sequences for d1ubpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d1ubpb_: