Lineage for d1ubpb_ (1ubp B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63938Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 63988Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 63989Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 63990Protein Urease, beta-subunit [51280] (2 species)
  7. 63991Species Bacillus pasteurii [TaxId:1474] [51282] (5 PDB entries)
  8. 63993Domain d1ubpb_: 1ubp B: [28346]
    Other proteins in same PDB: d1ubpa_, d1ubpc1, d1ubpc2

Details for d1ubpb_

PDB Entry: 1ubp (more details), 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution

SCOP Domain Sequences for d1ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOP Domain Coordinates for d1ubpb_:

Click to download the PDB-style file with coordinates for d1ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d1ubpb_: