SCOP 1.69: Domain d4ubpb_: 4ubp B:

Lineage for d4ubpb_ (4ubp B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (6 PDB entries)

8. Domain d4ubpb_: 4ubp B: [28345]
   Other proteins in same PDB: d4ubpa_, d4ubpc1, d4ubpc2

Details for d4ubpb_

PDB Entry: 4ubp, 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpb_:

Sequence; same for both SEQRES and ATOM records:

>d4ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d4ubpb_:

• d4ubpb_ first appeared (with stable ids) in SCOP 1.55
  
• d4ubpb_ appears in SCOP 1.67
  
• d4ubpb_ appears in SCOP 1.71
  
• d4ubpb_ appears in the current release, SCOPe 2.08