Lineage for d4ubpb_ (4ubp B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172178Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 172228Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 172229Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 172230Protein Urease, beta-subunit [51280] (3 species)
  7. 172231Species Bacillus pasteurii [TaxId:1474] [51282] (5 PDB entries)
  8. 172232Domain d4ubpb_: 4ubp B: [28345]
    Other proteins in same PDB: d4ubpa_, d4ubpc1, d4ubpc2

Details for d4ubpb_

PDB Entry: 4ubp (more details), 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOP Domain Coordinates for d4ubpb_:

Click to download the PDB-style file with coordinates for d4ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d4ubpb_: