SCOPe 2.06: Domain d1a5ob_: 1a5o B:

Lineage for d1a5ob_ (1a5o B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries)

8. Domain d1a5ob_: 1a5o B: [28344]
   Other proteins in same PDB: d1a5oa_, d1a5oc1, d1a5oc2
   complexed with fmt, ni

Details for d1a5ob_

PDB Entry: 1a5o, 2.5 Å

PDB Description: k217c variant of klebsiella aerogenes urease, chemically rescued by formate and nickel

PDB Compounds: (B:) urease (beta subunit)

SCOPe Domain Sequences for d1a5ob_:

Sequence; same for both SEQRES and ATOM records:

>d1a5ob_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1a5ob_:

• d1a5ob_ first appeared (with stable ids) in SCOP 1.55
  
• d1a5ob_ appears in SCOPe 2.05
  
• d1a5ob_ appears in SCOPe 2.07
  
• d1a5ob_ appears in the current release, SCOPe 2.08