Lineage for d1krcb_ (1krc B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678461Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 678462Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 678463Protein Urease, beta-subunit [51280] (3 species)
  7. 678474Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)
  8. 678501Domain d1krcb_: 1krc B: [28343]
    Other proteins in same PDB: d1krca_, d1krcc1, d1krcc2
    complexed with co2, ni; mutant

Details for d1krcb_

PDB Entry: 1krc (more details), 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants
PDB Compounds: (B:) urease

SCOP Domain Sequences for d1krcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krcb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOP Domain Coordinates for d1krcb_:

Click to download the PDB-style file with coordinates for d1krcb_.
(The format of our PDB-style files is described here.)

Timeline for d1krcb_: