Lineage for d1ef2b_ (1ef2 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1809317Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1809415Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 1809416Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 1809417Protein Urease, beta-subunit [51280] (4 species)
  7. 1809435Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)
  8. 1809460Domain d1ef2b_: 1ef2 B: [28341]
    Other proteins in same PDB: d1ef2a1, d1ef2a2, d1ef2c_
    complexed with mn

Details for d1ef2b_

PDB Entry: 1ef2 (more details), 2.5 Å

PDB Description: crystal structure of manganese-substituted klebsiella aerogenes urease
PDB Compounds: (B:) urease beta subunit

SCOPe Domain Sequences for d1ef2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef2b_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1ef2b_:

Click to download the PDB-style file with coordinates for d1ef2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ef2b_: