Class b: All beta proteins [48724] (144 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) |
Family b.85.3.1: Urease, beta-subunit [51279] (1 protein) |
Protein Urease, beta-subunit [51280] (3 species) |
Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries) |
Domain d1ef2b_: 1ef2 B: [28341] Other proteins in same PDB: d1ef2a1, d1ef2a2, d1ef2c_ |
PDB Entry: 1ef2 (more details), 2.5 Å
SCOP Domain Sequences for d1ef2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef2b_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes} mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d1ef2b_: