![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
![]() | Protein Urease, beta-subunit [51280] (4 species) |
![]() | Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries) |
![]() | Domain d1ejvb_: 1ejv B: [28340] Other proteins in same PDB: d1ejva_, d1ejvc1, d1ejvc2 complexed with ni |
PDB Entry: 1ejv (more details), 2.4 Å
SCOPe Domain Sequences for d1ejvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejvb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]} mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d1ejvb_: