Lineage for d1a5lb_ (1a5l B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139698Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 1139699Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 1139700Protein Urease, beta-subunit [51280] (4 species)
  7. 1139716Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)
  8. 1139736Domain d1a5lb_: 1a5l B: [28337]
    Other proteins in same PDB: d1a5la_, d1a5lc1, d1a5lc2

Details for d1a5lb_

PDB Entry: 1a5l (more details), 2.2 Å

PDB Description: k217c variant of klebsiella aerogenes urease
PDB Compounds: (B:) urease (beta subunit)

SCOPe Domain Sequences for d1a5lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5lb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1a5lb_:

Click to download the PDB-style file with coordinates for d1a5lb_.
(The format of our PDB-style files is described here.)

Timeline for d1a5lb_: