Class b: All beta proteins [48724] (149 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) |
Family b.85.3.1: Urease, beta-subunit [51279] (1 protein) |
Protein Urease, beta-subunit [51280] (3 species) |
Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries) |
Domain d1a5lb_: 1a5l B: [28337] Other proteins in same PDB: d1a5la_, d1a5lc1, d1a5lc2 mutant |
PDB Entry: 1a5l (more details), 2.2 Å
SCOP Domain Sequences for d1a5lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5lb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes} mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d1a5lb_: