SCOPe 2.06: Domain d1a5kb_: 1a5k B:

Lineage for d1a5kb_ (1a5k B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries)

8. Domain d1a5kb_: 1a5k B: [28336]
   Other proteins in same PDB: d1a5ka_, d1a5kc1, d1a5kc2

Details for d1a5kb_

PDB Entry: 1a5k, 2.2 Å

PDB Description: k217e variant of klebsiella aerogenes urease

PDB Compounds: (B:) urease (beta subunit)

SCOPe Domain Sequences for d1a5kb_:

Sequence; same for both SEQRES and ATOM records:

>d1a5kb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1a5kb_:

• d1a5kb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a5kb_ appears in SCOPe 2.05
  
• d1a5kb_ appears in SCOPe 2.07
  
• d1a5kb_ appears in the current release, SCOPe 2.08