SCOP 1.73: Domain d1fweb_: 1fwe B:

Lineage for d1fweb_ (1fwe B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1fweb_: 1fwe B: [28334]
   Other proteins in same PDB: d1fwea_, d1fwec1, d1fwec2
   complexed with hae, ni; mutant

Details for d1fweb_

PDB Entry: 1fwe, 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant with acetohydroxamic acid (aha) bound

PDB Compounds: (B:) urease

SCOP Domain Sequences for d1fweb_:

Sequence; same for both SEQRES and ATOM records:

>d1fweb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1fweb_:

• d1fweb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fweb_ appears in SCOP 1.71
  
• d1fweb_ appears in SCOP 1.75
  
• d1fweb_ appears in the current release, SCOPe 2.08