Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) |
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
Protein Urease, beta-subunit [51280] (4 species) |
Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries) |
Domain d1ejub_: 1eju B: [28333] Other proteins in same PDB: d1ejua_, d1ejuc1, d1ejuc2 complexed with ni |
PDB Entry: 1eju (more details), 2 Å
SCOPe Domain Sequences for d1ejub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejub_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]} mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d1ejub_: