Lineage for d1ejub_ (1eju B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560599Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 1560600Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 1560601Protein Urease, beta-subunit [51280] (4 species)
  7. 1560619Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)
  8. 1560634Domain d1ejub_: 1eju B: [28333]
    Other proteins in same PDB: d1ejua_, d1ejuc1, d1ejuc2
    complexed with ni

Details for d1ejub_

PDB Entry: 1eju (more details), 2 Å

PDB Description: crystal structure of the h320n variant of klebsiella aerogenes urease
PDB Compounds: (B:) urease beta subunit

SCOPe Domain Sequences for d1ejub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejub_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1ejub_:

Click to download the PDB-style file with coordinates for d1ejub_.
(The format of our PDB-style files is described here.)

Timeline for d1ejub_: