SCOPe 2.02: Domain d1ejsb_: 1ejs B:

Lineage for d1ejsb_ (1ejs B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1ejsb_: 1ejs B: [28332]
   Other proteins in same PDB: d1ejsa_, d1ejsc1, d1ejsc2
   complexed with ni

Details for d1ejsb_

PDB Entry: 1ejs, 2 Å

PDB Description: crystal structure of the h219n variant of klebsiella aerogenes urease

PDB Compounds: (B:) urease beta subunit

SCOPe Domain Sequences for d1ejsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ejsb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1ejsb_:

• d1ejsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ejsb_ appears in SCOPe 2.01
  
• d1ejsb_ appears in SCOPe 2.03
  
• d1ejsb_ appears in the current release, SCOPe 2.08