SCOPe 2.05: Domain d2kaub_: 2kau B:

Lineage for d2kaub_ (2kau B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d2kaub_: 2kau B: [28328]
   Other proteins in same PDB: d2kaua_, d2kauc1, d2kauc2
   CASP1
   complexed with ni

Details for d2kaub_

PDB Entry: 2kau, 2 Å

PDB Description: the crystal structure of urease from klebsiella aerogenes at 2.2 angstroms resolution

PDB Compounds: (B:) urease (beta chain)

SCOPe Domain Sequences for d2kaub_:

Sequence; same for both SEQRES and ATOM records:

>d2kaub_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d2kaub_:

• d2kaub_ first appeared (with stable ids) in SCOP 1.55
  
• d2kaub_ appears in SCOPe 2.04
  
• d2kaub_ appears in SCOPe 2.06
  
• d2kaub_ appears in the current release, SCOPe 2.08